DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and atoh1b

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001122151.1 Gene:atoh1b / 493915 ZFINID:ZDB-GENE-041201-1 Length:206 Species:Danio rerio


Alignment Length:109 Identity:43/109 - (39%)
Similarity:57/109 - (52%) Gaps:20/109 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DPPL---TSTPVKSPEDPNA---PRPKRKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNRM 167
            |.|:   .|:|..:.||.:|   .||..|.:|.        .|      :|.||:.||.|||.||
Zfish    56 DSPMEKYISSPQAASEDHHAGSKARPGSKASVS--------GP------QRHRRVAANARERRRM 106

  Fly   168 HNLNDALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALEQVLE 211
            |.||.|.:|||..:|||..|.||:|.:.|:.|..||..|.::||
Zfish   107 HGLNRAFDKLRSVIPSLENEKKLSKYDTLQMAQIYITELSELLE 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 27/51 (53%)
atoh1bNP_001122151.1 HLH 92..150 CDD:238036 29/57 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578708
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.