DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and NEUROD1

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_002491.3 Gene:NEUROD1 / 4760 HGNCID:7762 Length:356 Species:Homo sapiens


Alignment Length:305 Identity:93/305 - (30%)
Similarity:125/305 - (40%) Gaps:64/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PQPYSGGTWDAVPLSSPPAGFVGLLDTSSNHSTRSGRTLVEHLNSR---ATNG----VFDPPLTS 114
            |||....:|....|||          ....|........:|.:|:.   ..||    ..|..|..
Human    14 PQPQGPPSWTDECLSS----------QDEEHEADKKEDDLETMNAEEDSLRNGGEEEDEDEDLEE 68

  Fly   115 TPVKSPEDPNAPRPKRKYAVGKNRVTRSRSPTQVVKIKRF--RRMKANDRERNRMHNLNDALEKL 177
            ...:..||.: .:|||: ...|.::|::|       ::||  ||||||.|||||||.||.||:.|
Human    69 EEEEEEEDDD-QKPKRR-GPKKKKMTKAR-------LERFKLRRMKANARERNRMHGLNAALDNL 124

  Fly   178 RVTLPSLPEETKLTKIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSG--ERITKELFDA 240
            |..:|...:..||:|||.||.|.|||:||.::|.||.|  .||.........|  :..|..:...
Human   125 RKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKS--PDLVSFVQTLCKGLSQPTTNLVAGC 187

  Fly   241 LFVNPQPYPLFGRMFPYGQGMAPLAQH-QTAPASHAEQPPAMGGFQHGMDYPQQPPGFDFT--GS 302
            |.:||:.:     :....|.|.|   | .||.||....|           |..|.||....  |:
Human   188 LQLNPRTF-----LPEQNQDMPP---HLPTASASFPVHP-----------YSYQSPGLPSPPYGT 233

  Fly   303 MRFYHQQQQQPHQPHHLQPNPQQESSPQQ--FSQEKYDLFRGSFD 345
            |...|        ..|::|.|...|:..:  |.....|....|||
Human   234 MDSSH--------VFHVKPPPHAYSAALEPFFESPLTDCTSPSFD 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 32/51 (63%)
NEUROD1NP_002491.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..94 21/91 (23%)
bHLH_TS_NeuroD1 75..160 CDD:381562 44/93 (47%)
Nuclear localization signal. /evidence=ECO:0000255 87..93 1/5 (20%)
Neuro_bHLH 160..284 CDD:403655 34/140 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145433
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.