DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and ATOH1

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_005163.1 Gene:ATOH1 / 474 HGNCID:797 Length:354 Species:Homo sapiens


Alignment Length:379 Identity:88/379 - (23%)
Similarity:126/379 - (33%) Gaps:138/379 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DFGTPPTP-AIPQPYSGGTWDAVPLSSPPAGF-----------VGLLDTSSNHSTRSGRTLVEHL 99
            |....|.| .:|||        .|...|||..           :.||| |::.......||....
Human    18 DHHRQPQPHHLPQP--------PPPPQPPATLQAREHPVYPPELSLLD-STDPRAWLAPTLQGIC 73

  Fly   100 NSRATNGVF-DPPLTSTPVKSPED------------------PNAPRP----------KRKYAVG 135
            .:||...:. .|.|.::...:|.|                  ..:|.|          |....|.
Human    74 TARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVD 138

  Fly   136 KNRVTRSRSPT--QVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIEILRF 198
            :...:|.|:|:  ||..:::.||:.||.|||.|||.||.|.::||..:||...:.||:|.|.|:.
Human   139 ELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQM 203

  Fly   199 AHNYIFALEQVLE--SGGSINLDLEKLQNFTLSGERITKELFDALFVNPQPYPL----------F 251
            |..||.||.::|:  |||.                            .|.|.|.          .
Human   204 AQIYINALSELLQTPSGGE----------------------------QPPPPPASCKSDHHHLRT 240

  Fly   252 GRMFPYGQGMAPLA---------QHQTAPAS---HAEQPPAMGGFQHGMD--------------- 289
            ...:..|.|.|..|         |..|.|.|   ....|.:.||:...:|               
Human   241 AASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAM 305

  Fly   290 ------YPQQPPGFDFTGSMRFYHQQQQQPHQPHHLQPNPQQESSPQQFSQEKY 337
                  .|..|      ||:       .||.|..:.:.:|:...|..:||...:
Human   306 MAQKNLSPSLP------GSI-------LQPVQEENSKTSPRSHRSDGEFSPHSH 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 26/51 (51%)
ATOH1NP_005163.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 10/44 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..122 3/30 (10%)
HLH 158..216 CDD:238036 27/57 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..277 14/88 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..354 11/48 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.