DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and net

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster


Alignment Length:126 Identity:38/126 - (30%)
Similarity:58/126 - (46%) Gaps:30/126 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 RTLVEHLNSRATNGVF------DPPLTST---PVKSPEDPNAPRPKRKYAVGKNRVTRSRSPTQV 148
            :||.|.....:|:..|      |..|..|   |:..|.     :.:|.|   ||           
  Fly   219 KTLKERTQKESTSSSFLEASLSDEDLNKTGLAPISRPH-----QHQRNY---KN----------- 264

  Fly   149 VKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALEQV 209
              :.|.||::||.|||.|:|.::.|.|.||..:|:.....||:|:.:||.|.:||..|.::
  Fly   265 --MTRERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSRM 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 22/51 (43%)
netNP_001259789.1 HLH 269..320 CDD:278439 22/50 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446162
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.