DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and Fer3

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster


Alignment Length:195 Identity:48/195 - (24%)
Similarity:65/195 - (33%) Gaps:76/195 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 PKRKYAVGK-NRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLT 191
            |:|....|: |..:.|...|:.......:|..||.|||.||.|||:|.:|||..:|:...|.:|:
  Fly    59 PQRPSTNGRANGSSSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLS 123

  Fly   192 KIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSGERITKELFDALFVNPQPYPLFGRMFP 256
            :||.||.|..||..:.::                  |||                          
  Fly   124 RIETLRLAITYIGFMAEL------------------LSG-------------------------- 144

  Fly   257 YGQGMAPLAQHQTAPASHAEQPPAMGGFQHGMDYPQQPPGFDFTGSMRFYHQQQQQPHQPHHLQP 321
                        |...||..:.                   |..|||..:||.......||||.|
  Fly   145 ------------TPSNSHKSRS-------------------DVYGSMNGHHQAPPPAIHPHHLHP 178

  Fly   322  321
              Fly   179  178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 25/51 (49%)
Fer3NP_524322.1 HLH 87..135 CDD:278439 23/47 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.