DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and twi

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster


Alignment Length:308 Identity:69/308 - (22%)
Similarity:111/308 - (36%) Gaps:100/308 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YNAYSAGSQSFEFDEDDDDA----SFDSGYEKSFETEAQLSSRRRLDFGTPPTPAIPQPYSGGTW 65
            ||.....||..:..:....:    .|.:.|.:|||             |..|..::    :|..:
  Fly   241 YNNQQQQSQQLQQQQPHQQSHAQMHFQNAYRQSFE-------------GYEPANSL----NGSAY 288

  Fly    66 DAVPLSSPPAGFVGLLDTSSNHSTRSGRTLVEHLNSRATNGVFDPPLTSTPVKSP----EDPNA- 125
            .:                       |.|..:|:....|.:.|.|   .:..|.||    :|.:| 
  Fly   289 SS-----------------------SDRDDMEYARHNALSSVSD---LNGGVMSPACLADDGSAG 327

  Fly   126 -------------PRPKRKYAVGKNRVTRSRSPTQVVKIKRF--RRMKANDRERNRMHNLNDALE 175
                         .:|:|:.         .|.|::..:...|  :|:.||.|||.|..:||||.:
  Fly   328 SLLDGSDAGGKAFRKPRRRL---------KRKPSKTEETDEFSNQRVMANVRERQRTQSLNDAFK 383

  Fly   176 KLRVTLPSLPEETKLTKIEILRFAHNYIFALEQVLESG-----------------GSINLDLEKL 223
            .|:..:|:||.: ||:||:.|:.|..||..|.::|.|.                 ||.:..|...
  Fly   384 SLQQIIPTLPSD-KLSKIQTLKLATRYIDFLCRMLSSSDISLLKALEAQGSPSAYGSASSLLSAA 447

  Fly   224 QNFTLSGERITKELFDALFVNPQPYP-LFGRMFPYGQGMAPLAQHQTA 270
            .|...:..:..::...|..:.|:... |||.....|.     ||||.|
  Fly   448 ANGAEADLKCLRKANGAPIIPPEKLSYLFGVWRMEGD-----AQHQKA 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 23/51 (45%)
twiNP_001033967.1 HLH 363..413 CDD:278439 23/50 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.