DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and Bhlhe22

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001102410.1 Gene:Bhlhe22 / 365748 RGDID:1305451 Length:352 Species:Rattus norvegicus


Alignment Length:304 Identity:74/304 - (24%)
Similarity:107/304 - (35%) Gaps:85/304 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EAQLSSRRRLDFGTPPTP-----AIPQPYSGGTWDAVPLSSPP--AGFVGLLDTSSNHSTRSGRT 94
            |...||...|....|..|     .:|.|..||......:|.|.  .|..|:....|..|..:|..
  Rat    52 ERPASSSSPLGCFEPADPEGAGLLLPPPGGGGGASGGGVSVPGLLVGSAGVGGEPSLSSLPAGAA 116

  Fly    95 L-VEHLNSRATNGVFDPPLTSTPVKSPEDPN-----------APRPKRKYAVGKN--RVTRSRS- 144
            | :::..|.....|.:   :|...:||:|.:           .|.|:.....|..  :|....| 
  Rat   117 LCLKYGESAGRGSVAE---SSGGEQSPDDDSDGRCELVLRAGGPDPRASPGAGSGGAKVAEGCSN 178

  Fly   145 -------------PT------------QVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLP-- 182
                         ||            :..|.::..|:..|.|||.|||:|||||::||..:|  
  Rat   179 AHLHGGSGLPPGGPTSGSGGNGGGGSSKKSKEQKALRLNINARERRRMHDLNDALDELRAVIPYA 243

  Fly   183 SLPEETKLTKIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSGERITKELFDALFVNPQP 247
            ..|...||:||..|..|.|||....|.||       ::.:|..:...|:.|:             
  Rat   244 HSPSVRKLSKIATLLLAKNYILMQAQALE-------EMRRLVAYLNQGQAIS------------- 288

  Fly   248 YPLFGRMFPYGQGMAPLAQHQTAPASHAEQPPAMGGFQHGMDYP 291
                         .|.|.....|.|:.|...||:|.::....||
  Rat   289 -------------AASLPSSAAAAAAAAALHPALGAYEQAAGYP 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 26/53 (49%)
Bhlhe22NP_001102410.1 HLH 219..273 CDD:197674 28/60 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339119
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.