DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and hlh-31

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001023193.2 Gene:hlh-31 / 3565632 WormBaseID:WBGene00009540 Length:164 Species:Caenorhabditis elegans


Alignment Length:86 Identity:25/86 - (29%)
Similarity:48/86 - (55%) Gaps:6/86 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 RRMKAND-RERNRMHNLNDALEKLRVTLPSL--PEETKLTKIEILRFAHNYIFALEQVLESGGSI 216
            |:||::. .:|.|||:||:||:.||..:|..  ....||:||..|..|.|:|....:.:|   .:
 Worm    74 RKMKSSKLLKRCRMHDLNEALDDLRAVIPYAHGGSVRKLSKIATLLLAKNHIIMKAKAIE---EL 135

  Fly   217 NLDLEKLQNFTLSGERITKEL 237
            ::.:.:|:..:.:.:.:.|.:
 Worm   136 SVLVSQLKQKSENSKNLNKSV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 22/54 (41%)
hlh-31NP_001023193.2 bHLH_SF 78..137 CDD:381792 20/61 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.