DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and amos

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster


Alignment Length:185 Identity:53/185 - (28%)
Similarity:76/185 - (41%) Gaps:36/185 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PAIPQPYSGGTWDAV------------PLSSPPAGFVGL---LDTSS----NHSTRSGRTLVEHL 99
            ||||:..|..|:..:            ...|..|....|   .||.|    .|...:......||
  Fly    18 PAIPEFLSNDTFQQLEQLMYQQEFSTSDSQSDGANSCSLEMYYDTPSVLELEHMLNAQEQQQHHL 82

  Fly   100 NSRATNGVFDPPLTSTPVKSPEDPN---APRPKRKYAVGKNRVTRSRSPTQVV------KIKRFR 155
            .:.        ||.....:||...|   ..:|..|.:...:..|.|.|.:...      ::.:.|
  Fly    83 QAN--------PLGKNQGRSPRYWNKQQRSKPYDKLSTSMSSSTSSASSSSSSSAGFGGEVLKKR 139

  Fly   156 RMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALEQVL 210
            |:.||.|||.||::||||.:|||..:|||..:.:|:|.|.|:.|..||..|..:|
  Fly   140 RLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 26/51 (51%)
amosNP_477446.1 HLH 137..195 CDD:238036 28/58 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446155
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.