DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and Olig2

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001094027.1 Gene:Olig2 / 304103 RGDID:1307098 Length:323 Species:Rattus norvegicus


Alignment Length:401 Identity:90/401 - (22%)
Similarity:126/401 - (31%) Gaps:142/401 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ETEAQLSSRRRLDFGTPPTPAIPQP----------------YSGGT-WDAVPLSSPPAGFVGLLD 82
            :::|.|.|.|         |:.|:|                ::||| ..:.|...||       :
  Rat     2 DSDASLVSSR---------PSSPEPDDLFLPARSKGGSSSGFTGGTVSSSTPSDCPP-------E 50

  Fly    83 TSSNHSTRSGRTLVEHLNSRATNGVFDPPLTSTPVKSPEDPNAPRPKRKYAVGKNRVTRSRSPTQ 147
            .||......| |...|...:...|.|....:||...:.....:...|.|         :..:..:
  Rat    51 LSSELRGAMG-TAGAHPGDKLGGGGFKSSSSSTSSSTSSAATSSTKKDK---------KQMTEPE 105

  Fly   148 VVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSL--PEETKLTKIEILRFAHNYIFALEQVL 210
            :.::    |:|.|.|||.|||:||.|::.||..:|..  |...||:||..|..|.|||..|...|
  Rat   106 LQQL----RLKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSL 166

  Fly   211 ESGGSINLDLEKLQNFTLSGERITKELFDALFVNPQPYPLFGRMFPYGQGMA-----PLAQHQTA 270
            |                 ..:|:..|::........|...        .|:|     |.|....|
  Rat   167 E-----------------EMKRLVSEIYGGHHAGFHPSAC--------GGLAHSTPLPTATAHPA 206

  Fly   271 PASHAEQPPAMGGFQHGMDYPQQPP----------------------GFDFTGSMRFYHQQQQQP 313
            .|:||...||       :.:|..||                      |....||:|         
  Rat   207 AAAHAAHHPA-------VHHPILPPAAAAAAAAAAAAAVSSASLPGSGLSSVGSIR--------- 255

  Fly   314 HQPHHLQPNPQQESSPQQFSQEKYDLFRGSFDAAANLHSTNLDSGIHQQSSFYSQTPPWKDYPED 378
             .||.|..:|                   |..|||.|......||.......:...|    .|..
  Rat   256 -PPHGLLKSP-------------------SAAAAAPLGGGGGGSGGSGGFQHWGGMP----CPCS 296

  Fly   379 QAHVHPVPHQH 389
            ...| |.||.|
  Rat   297 MCQV-PPPHHH 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 25/53 (47%)
Olig2NP_001094027.1 bHLH_TS_OLIG2 95..179 CDD:381510 32/113 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339117
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.