DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and neurog1

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_571116.1 Gene:neurog1 / 30239 ZFINID:ZDB-GENE-990415-174 Length:208 Species:Danio rerio


Alignment Length:93 Identity:52/93 - (55%)
Similarity:65/93 - (69%) Gaps:6/93 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 KSPEDPNAPRPKRKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLP 182
            |.|..|...:.|      |.|..|:|:.|.|..:|:.||:|||||||||||||||||:.||..||
Zfish    40 KPPASPAGLQQK------KRRRGRARNETTVHVVKKNRRLKANDRERNRMHNLNDALDALRSVLP 98

  Fly   183 SLPEETKLTKIEILRFAHNYIFALEQVL 210
            :.|::|||||||.||||||||:||.:.:
Zfish    99 AFPDDTKLTKIETLRFAHNYIWALSETI 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 40/51 (78%)
neurog1NP_571116.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 8/27 (30%)
CCDC106 <20..>102 CDD:292422 34/67 (51%)
HLH 68..127 CDD:238036 42/59 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..180
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578699
Domainoid 1 1.000 86 1.000 Domainoid score I8049
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002069
OrthoInspector 1 1.000 - - otm26618
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4181
SonicParanoid 1 1.000 - - X1366
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.