DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and Mesp2

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001099743.1 Gene:Mesp2 / 293046 RGDID:1305959 Length:368 Species:Rattus norvegicus


Alignment Length:385 Identity:95/385 - (24%)
Similarity:126/385 - (32%) Gaps:144/385 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PQPYS-----------GGTWDAVPLSSPPAGFVGLLDTSSNHSTRSGRTLVEHLNSRATNGVFDP 110
            |||.|           |..|.....|:.||        ||:.|:.|       ....||.    |
  Rat     5 PQPQSLQGLDHWVFSQGWGWARHSDSTSPA--------SSSDSSGS-------CPCYATR----P 50

  Fly   111 PLTST-PVKSPED----PNAPRPKRKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNL 170
            |..|| |.:|..:    |||||..|....|.                  :|..|::||:.||..|
  Rat    51 PSQSTGPARSARNTQVAPNAPRRARPAPAGG------------------QRQSASEREKLRMRTL 97

  Fly   171 NDALEKLRVTLPS--LPEETKLTKIEILRFAHNYIFALEQVL----------------------- 210
            ..||::||..||.  .|....|||||.||.|..||..|..:|                       
  Rat    98 ARALQELRRFLPPSVAPAGQSLTKIETLRLAIRYIGHLSALLGLSEDSLRRRRRRSADAAFSHRC 162

  Fly   211 -----ES--------GGSINLDLEKLQNF----TLSGERITKELFDALFVNPQPY--PLFGRMFP 256
                 :|        |.|:..|:....::    ...|..|:.|...:...|..|:  |      |
  Rat   163 PQCPDDSSPSQAQMLGPSLGSDISSGLSWGCPPACPGPIISPENLGSRISNVDPWVTP------P 221

  Fly   257 Y-GQGMAPLAQ--HQTAPASHAEQPPAMGGFQHGMDYPQQPPGFDFTGS------MRFYHQQQQQ 312
            | .|..:||.|  .:.|..||...|.|..|.|...: |:...| .:|.|      .:.|......
  Rat   222 YCSQIQSPLHQSLERAADTSHWAPPHACPGMQISPE-PRNKTG-HWTASTEPAELTKVYQSLSVS 284

  Fly   313 PH------------QP--HHLQPNPQQESSPQQFSQEKYDLFRGSFDAAANLHSTNLDSG 358
            |.            :|  ..|||.||.                |.:|.:|...|::.|.|
  Rat   285 PEPCLALGSPPLLPRPSCQRLQPQPQW----------------GCWDHSAEALSSSEDQG 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 24/53 (45%)
Mesp2NP_001099743.1 HLH 82..135 CDD:278439 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.