DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and Olig3

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001099739.1 Gene:Olig3 / 293012 RGDID:1305997 Length:273 Species:Rattus norvegicus


Alignment Length:222 Identity:60/222 - (27%)
Similarity:84/222 - (37%) Gaps:70/222 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 RMKANDRERNRMHNLNDALEKLRVTLPSL--PEETKLTKIEILRFAHNYIFALEQVLESGGSINL 218
            |:|.|.|||.|||:||.|::.||..:|..  |...||:||..|..|.|||..|...||       
  Rat    86 RLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTSSLE------- 143

  Fly   219 DLEKLQNFTLSGERIT-----------KELFDALFVNPQPYPLFGRMFPYGQGMAPLA------- 265
            ::::|......|....           .....|..|:| .:|:.|.....|...:||:       
  Rat   144 EMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANAVHP-VHPILGGALSSGNASSPLSAASLPTI 207

  Fly   266 -----QHQ--TAPASHAEQPPAM---GGFQH--GMDYP----QQPPGFDFTGSMRFYHQQQQQPH 314
                 .|.  .||::    |||:   .||||  |:..|    |.||                   
  Rat   208 GTIRPPHSLLKAPST----PPALQLGSGFQHWAGLPCPCTICQMPP------------------- 249

  Fly   315 QPHHLQPNPQQESSPQQFSQEKYDLFR 341
             |.||  :....::..:.|.|..||.:
  Rat   250 -PPHL--SALSTANMARLSAESKDLLK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 25/52 (48%)
Olig3NP_001099739.1 bHLH_TS_OLIG3 70..150 CDD:381511 29/70 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339118
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.