DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and BHLHE22

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_689627.1 Gene:BHLHE22 / 27319 HGNCID:11963 Length:381 Species:Homo sapiens


Alignment Length:152 Identity:45/152 - (29%)
Similarity:65/152 - (42%) Gaps:35/152 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 SRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLP--SLPEETKLTKIEILRFAHNYIF 204
            |.|.::..|.::..|:..|.|||.|||:|||||::||..:|  ..|...||:||..|..|.|||.
Human   230 SSSSSKKSKEQKALRLNINARERRRMHDLNDALDELRAVIPYAHSPSVRKLSKIATLLLAKNYIL 294

  Fly   205 ALEQVLESGGSINLDLEKLQNFTLSGERITKELFDALFVNPQPYPLFGRMFPYGQGMAPLAQHQT 269
            ...|.||       ::.:|..:...|:.|:                          .|.|.....
Human   295 MQAQALE-------EMRRLVAYLNQGQAIS--------------------------AASLPSSAA 326

  Fly   270 APASHAEQPPAMGGFQHGMDYP 291
            |.|:.|...||:|.::....||
Human   327 AAAAAAALHPALGAYEQAAGYP 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 26/53 (49%)
BHLHE22NP_689627.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..94
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..154
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..242 3/11 (27%)
HLH 248..302 CDD:197674 28/60 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145430
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.