DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and neurod4

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_739568.2 Gene:neurod4 / 266958 ZFINID:ZDB-GENE-030730-1 Length:348 Species:Danio rerio


Alignment Length:295 Identity:85/295 - (28%)
Similarity:125/295 - (42%) Gaps:77/295 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 PKRKYAVGKNRVTRSRSPTQVVKIKRF--RRMKANDRERNRMHNLNDALEKLRVTLPSLPEETKL 190
            |||: ...|.::|::|.       :||  ||:|||.|||:|||.|||||:.||..:|...:..||
Zfish    77 PKRR-GPKKKKMTKARQ-------ERFRARRIKANARERSRMHGLNDALDNLRRVMPCYSKTQKL 133

  Fly   191 TKIEILRFAHNYIFALEQVLESG------GSINLDLEKLQNFTLS--------GERITKELFDAL 241
            :|||.||.|.|||:||.:|||||      |.:.:..:.|...|.:        |.....:|.:..
Zfish   134 SKIETLRLARNYIWALSEVLESGQSPESHGFVEMLCKGLSQPTSNLVAGCLQLGPTTMLKLDEKC 198

  Fly   242 FVN----PQPYPLFGRMFPYGQGMAPLAQHQTAPASHA------EQPPAMGGFQHG--------- 287
            .|.    ||.:|:     .|.....|...:.|..|||.      :.||    :::.         
Zfish   199 GVPGAGVPQGHPI-----SYPSPGLPSPPYGTMEASHLLHLKGYKGPP----YENSSPNECSSGT 254

  Fly   288 --MDYPQQPPGFDFTGSMRFYHQQQQQ-------PHQPHHLQPNPQQESS------PQ---QFSQ 334
              .|.|..|| ...:|:.....:...:       ||..|::..:|...:|      ||   .|..
Zfish   255 PPYDGPLTPP-LSISGNFALKQEPSPREAERNFTPHPTHYISSHPYPPTSLAGLPAPQGHPLFPG 318

  Fly   335 EKYDL-FRGSFDAAANLHSTNLDSGIHQQSSFYSQ 368
            .:|:| ...:|:..|..|...     .|.||.||:
Zfish   319 SRYELPLDMAFEPFAPSHIVT-----SQMSSIYSE 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 31/51 (61%)
neurod4NP_739568.2 HLH 98..154 CDD:238036 33/55 (60%)
Neuro_bHLH 156..272 CDD:289310 23/125 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578711
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.