DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and Bhlha15

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_036995.1 Gene:Bhlha15 / 25334 RGDID:3091 Length:197 Species:Rattus norvegicus


Alignment Length:262 Identity:64/262 - (24%)
Similarity:91/262 - (34%) Gaps:99/262 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PPLTSTPVKSPE-DPNAPRPKRKYA-VGKNRVT---RSR----SPTQVVKIKR------------ 153
            ||...||::..| .|....|.|..: .|.:.||   |||    |.|:....:|            
  Rat     7 PPRRRTPMQDAEATPGEQTPDRSQSGSGASEVTKGLRSRTARASGTRAEVSRRRQGSSSRRENSV 71

  Fly   154 FRRMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALEQVLESGGSINL 218
            .||:::|:|||.|||.||:|.:.||..:|.:..:.||:|||.|..|.|||.:|...:        
  Rat    72 QRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATI-------- 128

  Fly   219 DLEKLQNFTLSGERITKELFDALFVNPQPYPLFGRMFPYGQGMAPLAQHQTAPASHAEQP-PAMG 282
                   .|:|..|:                                     |...|..| |...
  Rat   129 -------LTMSSSRL-------------------------------------PGLEAPGPAPGPK 149

  Fly   283 GFQHGMDYPQQPPGFDFTGSMRFYHQQQQQPHQPHHLQ------PNPQQESSPQQFSQEKYDLFR 341
            .:||                   ||.||||..|...:.      ...|.:...|::|.:.:....
  Rat   150 LYQH-------------------YHHQQQQQQQQQQVAGAVLGVTEDQPQGHLQRYSTQIHSFRE 195

  Fly   342 GS 343
            ||
  Rat   196 GS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 25/51 (49%)
Bhlha15NP_036995.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..82 21/74 (28%)
HLH 70..124 CDD:238036 25/53 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..197 3/21 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.