powered by:
Protein Alignment tap and id3
DIOPT Version :9
Sequence 1: | NP_524124.1 |
Gene: | tap / 39935 |
FlyBaseID: | FBgn0015550 |
Length: | 398 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_694499.1 |
Gene: | id3 / 246093 |
ZFINID: | ZDB-GENE-020515-1 |
Length: | 116 |
Species: | Danio rerio |
Alignment Length: | 57 |
Identity: | 21/57 - (36%) |
Similarity: | 36/57 - (63%) |
Gaps: | 1/57 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 156 RMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALEQVLES 212
|.|:...|.:.| |:||...||:..:||:|:...::::|||:...:|||.|:..||:
Zfish 29 RCKSPSEELSDM-NMNDCYSKLKELVPSIPQNKSVSQVEILQHVIDYIFDLQIALEN 84
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
tap | NP_524124.1 |
HLH |
155..207 |
CDD:278439 |
18/50 (36%) |
id3 | NP_694499.1 |
HLH |
<41..79 |
CDD:278439 |
14/37 (38%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.