DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and ATOH7

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_660161.1 Gene:ATOH7 / 220202 HGNCID:13907 Length:152 Species:Homo sapiens


Alignment Length:110 Identity:39/110 - (35%)
Similarity:52/110 - (47%) Gaps:18/110 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 RRMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALEQVL---ESGGS- 215
            ||:.||.|||.||..||.|.::||..:|...::.||:|.|.|:.|.:||.||.::|   |..|| 
Human    41 RRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSE 105

  Fly   216 ---INLDLE--------KLQNFTLSGERITKELFDALFVNPQPYP 249
               :.|..|        ......|.||   .||:.......||.|
Human   106 RDWVGLHCEHFGRDHYLPFPGAKLPGE---SELYSQRLFGFQPEP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 24/51 (47%)
ATOH7NP_660161.1 bHLH_TS_ATOH7 34..102 CDD:381557 27/60 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145431
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.