DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and Tal2

DIOPT Version :10

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_033343.1 Gene:Tal2 / 21350 MGIID:99540 Length:108 Species:Mus musculus


Alignment Length:56 Identity:25/56 - (44%)
Similarity:35/56 - (62%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 RRMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALEQVL 210
            |::..|.|||.|..::|:|..|||..:|:.|.:.||:|.|.||.|..||..|.:||
Mouse     3 RKIFTNTRERWRQQSVNNAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVL 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 bHLH_TS_NGN 155..211 CDD:381434 25/56 (45%)
Tal2NP_033343.1 bHLH_SF 2..62 CDD:469605 25/56 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..108
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.