DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and hlh-17

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_502928.3 Gene:hlh-17 / 185460 WormBaseID:WBGene00001961 Length:101 Species:Caenorhabditis elegans


Alignment Length:84 Identity:28/84 - (33%)
Similarity:46/84 - (54%) Gaps:5/84 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 RMKANDRERNRMHNLNDALEKLRVTLPSL--PEETKLTKIEILRFAHNYIFALEQVLESGGSINL 218
            |:..|.|||.|||:||:||:.||..:|..  ....||:||..|..|.|:|....:.:|   .:::
 Worm    16 RLSINLRERCRMHDLNEALDDLRAVIPYAHGGSVRKLSKIATLLLAKNHIIMQAKAIE---ELSI 77

  Fly   219 DLEKLQNFTLSGERITKEL 237
            .:.:|:..:.:.|.:.|.|
 Worm    78 LVSQLKRKSENLENLNKSL 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 23/52 (44%)
hlh-17NP_502928.3 bHLH_TS_bHLHe22_like 16..76 CDD:381474 24/62 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.