DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and hlh-16

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_492372.2 Gene:hlh-16 / 183973 WormBaseID:WBGene00001960 Length:146 Species:Caenorhabditis elegans


Alignment Length:116 Identity:33/116 - (28%)
Similarity:52/116 - (44%) Gaps:16/116 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RPKRKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSLPEET--- 188
            |.||..|.|:.::.......|     ...|...|.|||.|||.|||..|.||..|| .|.|.   
 Worm    18 RRKRSEAGGRKKMQGLNEQEQ-----NLLRNSINSRERRRMHELNDEFETLRECLP-YPNEANSR 76

  Fly   189 KLTKIEILRFAHNYIFALEQVLESGGSINLDLE----KLQNFTLSGERITK 235
            :::|...|..|.|:|   :|:..:...:.::|.    |:.:..:..:::.|
 Worm    77 RMSKANTLLLASNWI---KQLANANHKLQMELNMANAKIDSLMVQLKKVEK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 23/54 (43%)
hlh-16NP_492372.2 bHLH_TS 42..96 CDD:381396 24/57 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.