DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and OLIG3

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_786923.1 Gene:OLIG3 / 167826 HGNCID:18003 Length:272 Species:Homo sapiens


Alignment Length:219 Identity:60/219 - (27%)
Similarity:84/219 - (38%) Gaps:64/219 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 RMKANDRERNRMHNLNDALEKLRVTLPSL--PEETKLTKIEILRFAHNYIFALEQVLESGGSINL 218
            |:|.|.|||.|||:||.|::.||..:|..  |...||:||..|..|.|||..|...||       
Human    85 RLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTSSLE------- 142

  Fly   219 DLEKLQNFTLSGERIT-----------KELFDALFVNPQPYPLFGRMFPYGQGMAPLAQHQTAPA 272
            ::::|......|....           .....|..|:| .:|:.|.....|...:||:. .:.||
Human   143 EMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANSVHP-VHPILGGALSSGNASSPLSA-ASLPA 205

  Fly   273 ------SHA-----EQPPAM---GGFQH--GMDYP----QQPPGFDFTGSMRFYHQQQQQPHQPH 317
                  .|:     ..|||:   .||||  |:..|    |.||                    |.
Human   206 IGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPCPCTICQMPP--------------------PP 250

  Fly   318 HLQPNPQQESSPQQFSQEKYDLFR 341
            ||  :....::..:.|.|..||.:
Human   251 HL--SALSTANMARLSAESKDLLK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 25/52 (48%)
OLIG3NP_786923.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71
HLH 85..138 CDD:306515 25/52 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145429
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.