DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and Id1

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001355947.1 Gene:Id1 / 15901 MGIID:96396 Length:168 Species:Mus musculus


Alignment Length:50 Identity:15/50 - (30%)
Similarity:31/50 - (62%) Gaps:0/50 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 MHNLNDALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALEQVLESGGSI 216
            ::::|....:|:..:|:||:..|::|:|||:...:||..|:..|.|...:
Mouse    59 LYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEV 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 12/39 (31%)
Id1NP_001355947.1 Interaction with IFI204. /evidence=ECO:0000250 53..106 15/46 (33%)
HLH <61..102 CDD:238036 13/40 (33%)
Nuclear export signal 91..104 4/12 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.