DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and Neurog3

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_033849.3 Gene:Neurog3 / 11925 MGIID:893591 Length:214 Species:Mus musculus


Alignment Length:255 Identity:84/255 - (32%)
Similarity:108/255 - (42%) Gaps:66/255 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PQPYSGGTWDAVPLSSPPAGFVGLLD--TSSNHSTRSGRTLVEHLNSRATNGVFDPPLTSTPVKS 119
            |.|....|....|.:..|  |.|..|  ..|::||....||:....|.|..|  |...||..:::
Mouse     3 PHPLDALTIQVSPETQQP--FPGASDHEVLSSNSTPPSPTLIPRDCSEAEVG--DCRGTSRKLRA 63

  Fly   120 PEDPNAPRPKRKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSL 184
            ... ...|||.:.|:.|.|              |.||.||||||||||||||.||:.||..||:.
Mouse    64 RRG-GRNRPKSELALSKQR--------------RSRRKKANDRERNRMHNLNSALDALRGVLPTF 113

  Fly   185 PEETKLTKIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSGERITKELFDALFVNPQP-- 247
            |::.||||||.||||||||:||.|.|                         .:.|..|..|:|  
Mouse   114 PDDAKLTKIETLRFAHNYIWALTQTL-------------------------RIADHSFYGPEPPV 153

  Fly   248 ------YPLFGRMFPYGQGMAPLAQ-HQTAPASHAEQPPAMGGFQHGMDYPQQP----PG 296
                  .|..|....:|...:|::| ...:|.:..|:.|       |:..|..|    ||
Mouse   154 PCGELGSPGGGSNGDWGSIYSPVSQAGNLSPTASLEEFP-------GLQVPSSPSYLLPG 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 38/51 (75%)
Neurog3NP_033849.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..98 38/113 (34%)
HLH 81..140 CDD:238036 43/97 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835502
Domainoid 1 1.000 81 1.000 Domainoid score I8476
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002069
OrthoInspector 1 1.000 - - otm44332
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4181
SonicParanoid 1 1.000 - - X1366
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.