DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and Neurog2

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_033848.1 Gene:Neurog2 / 11924 MGIID:109619 Length:263 Species:Mus musculus


Alignment Length:264 Identity:79/264 - (29%)
Similarity:109/264 - (41%) Gaps:95/264 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 TSTPVKSPED---------PNAPRPKRKYAVG--------------------------KNRVTRS 142
            |.||:.|..|         |.:.|.:|....|                          |.|.:||
Mouse    29 TLTPMSSSADEEEDEELRRPGSARGQRGAEAGQGVQGSPASGAGGCRPGRLLGLMHECKRRPSRS 93

  Fly   143 RSPTQ-------VVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIEILRFAH 200
            |:.::       |.:||:.||:|||:||||||||||.||:.||..||:.||:.||||||.|||||
Mouse    94 RAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAH 158

  Fly   201 NYIFALEQVLE-------SGGSINLDLEKLQNFTLSGERITKELFDALFVNPQPYPLFGRMFPYG 258
            |||:||.:.|.       :||             |.|...|    :|:.::|.     ..:...|
Mouse   159 NYIWALTETLRLADHCAGAGG-------------LQGALFT----EAVLLSPG-----AALGASG 201

  Fly   259 QGMAP-----------LAQHQTAPASHAEQPPAMGGFQHGMDYPQQPPGFDFTGSMRFYHQQQQQ 312
            ...:|           .:.:.|:|.|....|.:.|.   .:||.|.||.          .:.:..
Mouse   202 DSPSPPSSWSCTNSPASSSNSTSPYSCTLSPASPGS---DVDYWQPPPP----------EKHRYA 253

  Fly   313 PHQP 316
            ||.|
Mouse   254 PHLP 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 38/51 (75%)
Neurog2NP_033848.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..76 9/46 (20%)
bHLH_TS_NGN2_ATOH4 104..172 CDD:381560 43/67 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..253 12/68 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835466
Domainoid 1 1.000 81 1.000 Domainoid score I8476
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002069
OrthoInspector 1 1.000 - - otm44332
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1366
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.800

Return to query results.
Submit another query.