DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and Neurod4

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001316418.1 Gene:Neurod4 / 11923 MGIID:108055 Length:330 Species:Mus musculus


Alignment Length:300 Identity:86/300 - (28%)
Similarity:121/300 - (40%) Gaps:86/300 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 EDPNAPRPKRKYAVGKNRVTRSRSPTQVVKIKRF--RRMKANDRERNRMHNLNDALEKLRVTLPS 183
            |:.:..:|||: ...|.::|::|       ::||  ||:|||.|||.|||.|||||:.||..:|.
Mouse    60 EEEDGDKPKRR-GPKKKKMTKAR-------LERFRARRVKANARERTRMHGLNDALDNLRRVMPC 116

  Fly   184 LPEETKLTKIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSGERITKELFDALFVNPQPY 248
            ..:..||:|||.||.|.|||:||.:|||:|.            ||.|:...:.|...|   .|| 
Mouse   117 YSKTQKLSKIETLRLARNYIWALSEVLETGQ------------TLEGKGFVEMLCKGL---SQP- 165

  Fly   249 PLFGRMFPYGQGMAPLAQHQTAPASHAEQPPAMGG--FQHGMDYPQQPPGFDFTGSMRFYHQQQQ 311
                 ......|...|....|....|.|:......  ..|..:|  |.||.              
Mouse   166 -----TSNLVAGCLQLGPQSTLLEKHEEKSSICDSTISVHSFNY--QSPGL-------------- 209

  Fly   312 QPHQPH--------HLQPNPQQE------SSPQQFSQEKYD-------LFRGSF----DAAANLH 351
             |..|:        ||:|.|.:.      |.|...|...|:       ...|:|    |.:.:|.
Mouse   210 -PSPPYGHMETHSLHLKPQPFKSLGDSFGSHPPDCSTPPYEGPLTPPLSISGNFSLKQDGSPDLE 273

  Fly   352 ----------STNLDSGIHQQSSFYSQTPPWKDYPEDQAH 381
                      |.:|.||....:.|.:.||.: |.|.|.::
Mouse   274 KSYNFMPHYTSASLSSGHVHSTPFQTGTPRY-DVPVDLSY 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 31/51 (61%)
Neurod4NP_001316418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..80 6/20 (30%)
HLH 88..144 CDD:238036 33/55 (60%)
Neuro_bHLH 146..263 CDD:289310 29/154 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835503
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.