DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and OLIG1

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_620450.2 Gene:OLIG1 / 116448 HGNCID:16983 Length:271 Species:Homo sapiens


Alignment Length:253 Identity:66/253 - (26%)
Similarity:89/253 - (35%) Gaps:77/253 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GTPPTPAIPQPYSGGT--WDAVPLSSPPAGFVGLLDTSSNHSTRSGRTLVEHLNSRATNGVFDPP 111
            ||...|..|.....|.  ::.|....||:.     .:||..||.|       .:|.:|.....|.
Human    15 GTMLRPQRPGDLQLGASLYELVGYRQPPSS-----SSSSTSSTSS-------TSSSSTTAPLLPK 67

  Fly   112 LTSTPVKSPEDPNAPRPKRKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEK 176
            ......::|.:|..|.|    ..|.:....:|...:..:.::.|| |.|.|||.||.:||.|::.
Human    68 AAREKPEAPAEPPGPGP----GSGAHPGGSARPDAKEEQQQQLRR-KINSRERKRMQDLNLAMDA 127

  Fly   177 LR-VTLP-------SLPEETKLTKIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSGERI 233
            || |.||       ..|.. ||:||..|..|.|||..|      |.|:                 
Human   128 LREVILPYSAAHCQGAPGR-KLSKIATLLLARNYILLL------GSSL----------------- 168

  Fly   234 TKELFDALFVNPQPYPLFGRMFPYGQGMAPLAQH---------QTAPASHAEQPPAMG 282
             :||..||                |:|..|.|..         ..||.|....|.|:|
Human   169 -QELRRAL----------------GEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVG 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 27/59 (46%)
OLIG1NP_620450.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..117 23/95 (24%)
HLH 107..164 CDD:278439 27/58 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145432
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.