DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and neurod6b

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001296772.1 Gene:neurod6b / 114415 ZFINID:ZDB-GENE-010608-2 Length:332 Species:Danio rerio


Alignment Length:359 Identity:85/359 - (23%)
Similarity:123/359 - (34%) Gaps:133/359 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GTWDAVPLSSPPAGFVGLLDTSSNHSTRSGRTLVEHLNSRATNGVFDPPLTSTPVKSPEDPNAPR 127
            ||...||...|          .....::.|.|.....:.|.        |:|..:|..||.|..|
Zfish    14 GTMLTVPFEEP----------DMMRESQFGATFTRQEDVRT--------LSSAELKEAEDDNTDR 60

  Fly   128 ------------------PKRKYAVGK-NRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDA 173
                              |::|.:.|: :||             :.||.:||.|||:|||.||||
Zfish    61 EEEEEREEDENGLPKKKGPRKKKSEGRGDRV-------------KMRRQEANARERSRMHGLNDA 112

  Fly   174 LEKLRVTLPSLPEETKLTKIEILRFAHNYIFALEQVLESG------------------------- 213
            ||.||..:|...:..||:|||.||.|.|||:||.:.|.:|                         
Zfish   113 LESLRKVVPCYSKTQKLSKIETLRLAKNYIWALSETLSAGKRPDLLAFVQTLCKGLSQPTTNLVA 177

  Fly   214 GSINLDLEKLQNF--------TLSGERITKELFDALFVNP---------------------QPYP 249
            |.:.|:   .:||        :.||    :..:|:|:..|                     :||.
Zfish   178 GCLQLN---ARNFLTDHNGDVSFSG----RPAYDSLYPYPNAEMATPTGLSSGTRESVKPFRPYN 235

  Fly   250 LFGRMFPYGQGMAPLAQH-----QTAP----------ASHAEQPPAMGGFQHGMDYPQQPPGFDF 299
            .:.....|....:|.:..     |.:|          ..|.||........:||.|...|.    
Zfish   236 YYASYESYYDSASPESSSPHFDGQMSPPINYNGIFSLKKHDEQVEYSKNCHYGMRYCNVPG---- 296

  Fly   300 TGSMRFYHQQQQQPHQPHHLQPNPQQESSPQQFS 333
            .|||   ::.....|.|:.|.|..|...|..:.:
Zfish   297 RGSM---YRVSPDSHFPYDLHPRSQSFQSQDELN 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 31/51 (61%)
neurod6bNP_001296772.1 HLH 92..150 CDD:238036 32/57 (56%)
Neuro_bHLH 152..271 CDD:289310 16/125 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578664
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.