DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and OLIG2

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_005797.1 Gene:OLIG2 / 10215 HGNCID:9398 Length:323 Species:Homo sapiens


Alignment Length:400 Identity:87/400 - (21%)
Similarity:124/400 - (31%) Gaps:140/400 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ETEAQLSSRRRLDFGTPPTPAIPQP----------------YSGGT-WDAVPLSSPP---AGFVG 79
            :::|.|.|.|         |:.|:|                ::||| ..:.|...||   |...|
Human     2 DSDASLVSSR---------PSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRG 57

  Fly    80 LLDTSSNH-STRSGRTLVEHLNSRATNGVFDPPLTSTPVKSPEDPNAPRPKRKYAVGKNRVTRSR 143
            .:.::..| ..:.|.:..:..:|..::.......:||. |..:....|..::             
Human    58 AMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTK-KDKKQMTEPELQQ------------- 108

  Fly   144 SPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSL--PEETKLTKIEILRFAHNYIFAL 206
                       .|:|.|.|||.|||:||.|::.||..:|..  |...||:||..|..|.|||..|
Human   109 -----------LRLKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILML 162

  Fly   207 EQVLESGGSINLDLEKLQNFTLSGERITKELFDALFVNPQPYPLFGRMFPYGQGMAPLAQHQTAP 271
            ...||                 ..:|:..|::........|....|...   ....|.|....|.
Human   163 TNSLE-----------------EMKRLVSEIYGGHHAGFHPSACGGLAH---SAPLPAATAHPAA 207

  Fly   272 ASHAEQPPAMGGFQHGMDYPQQPP----------------------GFDFTGSMRFYHQQQQQPH 314
            |:||...||       :.:|..||                      |....||:|          
Human   208 AAHAAHHPA-------VHHPILPPAAAAAAAAAAAAAVSSASLPGSGLPSVGSIR---------- 255

  Fly   315 QPHHLQPNPQQESSPQQFSQEKYDLFRGSFDAAANLHSTNLDSGIHQQSSFYSQTPPWKDYPEDQ 379
            .||.|..:|                   |..|||.|......||.......:...|    .|...
Human   256 PPHGLLKSP-------------------SAAAAAPLGGGGGGSGASGGFQHWGGMP----CPCSM 297

  Fly   380 AHVHPVPHQH 389
            ..| |.||.|
Human   298 CQV-PPPHHH 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 25/53 (47%)
OLIG2NP_005797.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..107 22/114 (19%)
bHLH_TS_OLIG2 95..179 CDD:381510 32/125 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145428
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.