DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and atoh1

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_004911142.1 Gene:atoh1 / 100488309 XenbaseID:XB-GENE-6452084 Length:260 Species:Xenopus tropicalis


Alignment Length:268 Identity:70/268 - (26%)
Similarity:96/268 - (35%) Gaps:79/268 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LSSPPAGFVG---LLDTSSNHSTRSGRTL------VEHLNSRA--------TNGVFDPPLTSTPV 117
            |.|.| |.:|   |||:|...|..|..:|      |.|...||        ..|:.|        
 Frog    18 LPSEP-GLLGRDYLLDSSDPRSWLSAASLQSRPEYVLHPQGRAHKVRELCKLKGLQD-------- 73

  Fly   118 KSPEDPNAPRPKRKYAVG--KNRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVT 180
              .||........:.:.|  ::|....:.|..|   ::.||:.||.|||.|||.||.|.::||..
 Frog    74 --EEDEEEEEDDEETSEGLCRHRGGPGKGPGGV---QKQRRLAANARERRRMHGLNHAFDQLRNV 133

  Fly   181 LPSLPEETKLTKIEILRFAHNYIFALEQVLE-----------------SGGSINLDLEKLQNFTL 228
            :||...:.||:|.|.|:.|..||.||..:|:                 |||...|          
 Frog   134 IPSFNNDKKLSKYETLQMAQIYINALSDLLQAPPDTRDPPCPPTYQLHSGGEPRL---------- 188

  Fly   229 SGERITKELFDALFVNPQPYPLFGRMFPYGQGM-----------APLAQHQTAPASHAEQPPAMG 282
             .:..:...|...|....|...   .|..|.|:           :|....:|:|.||...    |
 Frog   189 -AQSASCRRFSGDFPGQSPLSF---QFQEGAGLSQKGMVSASSASPGEDSKTSPRSHRSD----G 245

  Fly   283 GFQHGMDY 290
            .|.....|
 Frog   246 EFSPNSHY 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 26/51 (51%)
atoh1XP_004911142.1 bHLH_TS_ATOH1 103..166 CDD:381556 29/65 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.