DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and bhlha15

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_017952828.2 Gene:bhlha15 / 100485413 XenbaseID:XB-GENE-877127 Length:175 Species:Xenopus tropicalis


Alignment Length:185 Identity:53/185 - (28%)
Similarity:69/185 - (37%) Gaps:72/185 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RPKRKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLT 191
            :.||:.|.||...|              ||:::|:|||.|||.||:|.:.||..:|.:..|.||:
 Frog    53 KKKRETANGKEHST--------------RRLESNERERQRMHKLNNAFQALREVIPHVRAEKKLS 103

  Fly   192 KIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSGERITKELFDALFVNPQPYPLFGRMFP 256
            |||.|..|.|||..|...:     :|:                                      
 Frog   104 KIETLTLAKNYINTLTATI-----LNM-------------------------------------- 125

  Fly   257 YGQGMAPLAQHQTAPASHAEQPPAMGG--FQHGMDYPQQPPGFDFTGSMRFYHQQ 309
             ..|.|       ||..  |..||.||  |||   |.||....|..|.::.|..|
 Frog   126 -SSGCA-------APGQ--EGRPANGGKLFQH---YQQQHSDEDNDGHLKQYSTQ 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 26/51 (51%)
bhlha15XP_017952828.2 bHLH_SF 67..128 CDD:412148 28/104 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.