DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and neurog3

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_002935814.2 Gene:neurog3 / 100038294 XenbaseID:XB-GENE-876279 Length:226 Species:Xenopus tropicalis


Alignment Length:204 Identity:74/204 - (36%)
Similarity:96/204 - (47%) Gaps:58/204 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 FDPPLT---STPVKSPED------PNAPR-PKRKYAVGKNRVTRSRSP----TQVVKIKRFRRMK 158
            |.||.|   ...:...||      .:.|| .:||    |.:|.|.||.    |.|:|.:|.||:|
 Frog    30 FSPPCTPDSQLSLAESEDCTLVDGYSHPRGNERK----KQKVKRMRSKVKSNTTVIKQRRNRRVK 90

  Fly   159 ANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALEQVLESG---------- 213
            |||||||||||||.||:.||..||:.|::.||||||.||||||||:||.:.|...          
 Frog    91 ANDRERNRMHNLNSALDALRSVLPTFPDDAKLTKIETLRFAHNYIWALSETLRMADQSLLSPEQQ 155

  Fly   214 -----------GSINLDLEKLQNFTLSGERITKELFDALFVNPQPYPLF--GRMFPYGQGMAPLA 265
                       ..:.:||....:.|.|.|      :|:|:     .|||  ..:.|.|      :
 Frog   156 HLLDSLKKLPKSCLMMDLSSPTSSTSSTE------WDSLY-----SPLFQDSSLSPTG------S 203

  Fly   266 QHQTAPASH 274
            ..:..|.||
 Frog   204 MDELMPQSH 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 38/51 (75%)
neurog3XP_002935814.2 bHLH_TS_NGN3_ATOH5 80..147 CDD:381561 43/66 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8286
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002069
OrthoInspector 1 1.000 - - otm49509
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1366
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.