DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and olig1

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001018632.1 Gene:olig1 / 100001484 ZFINID:ZDB-GENE-050107-2 Length:235 Species:Danio rerio


Alignment Length:184 Identity:45/184 - (24%)
Similarity:64/184 - (34%) Gaps:52/184 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 RSRSPTQVVKIKRFR--RMKANDRERNRMHNLNDALEKLRVTL--------------------PS 183
            ||..|.:.:..:..:  |.|.|.|||.||.:||.|::.||..:                    |.
Zfish    45 RSSKPPRELSSEEQQELRRKINSRERKRMQDLNVAMDALREVMVPYSSSPTGVGGALQHPYFPPG 109

  Fly   184 LPEE-TKLTKIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSGERITKELFDALFVNPQP 247
            .|.. .:|:||..|..|.|||..|       ||...::.:|......|..::..:...|.....|
Zfish   110 APTTGRRLSKISTLVLARNYILLL-------GSSLQEMRRLLGEVSIGMGVSGTVPRLLLTGGWP 167

  Fly   248 YPLFG------------------RMFPYGQGMAPLAQHQTAPASHAEQPPAMGG 283
            : |.|                  .:.|.|....|||   ..|.|.:|.|....|
Zfish   168 F-LTGPGQLLLSPPEQQLGVAKCPLLPQGAQEEPLA---WGPGSMSESPVCQCG 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 23/74 (31%)
olig1NP_001018632.1 HLH domain 62..139 26/83 (31%)
HLH 62..133 CDD:278439 23/70 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578703
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.