powered by:
Protein Alignment Mip and nlp-38
DIOPT Version :9
Sequence 1: | NP_648971.1 |
Gene: | Mip / 39933 |
FlyBaseID: | FBgn0036713 |
Length: | 211 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001252154.1 |
Gene: | nlp-38 / 173209 |
WormBaseID: | WBGene00007219 |
Length: | 120 |
Species: | Caenorhabditis elegans |
Alignment Length: | 94 |
Identity: | 22/94 - (23%) |
Similarity: | 26/94 - (27%) |
Gaps: | 56/94 - (59%) |
- Green bases have known domain annotations that are detailed below.
Fly 167 GWNKFRGAWGKRE-----------PTWNNLKGMWGKRD--------------------------- 193
||||..|.||||. ..||.|..:||||.
Worm 27 GWNKAHGLWGKRSVQEASQDKRTPQNWNKLNSLWGKRSASSFDDDYTTENGDDDVTMLYKRSNLS 91
Fly 194 ------------------QWQKLHGGWGK 204
|||:.:|.||:
Worm 92 PRFLGRMTFARIPKISPAQWQRANGLWGR 120
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160163838 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.