DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mip and nlp-38

DIOPT Version :9

Sequence 1:NP_648971.1 Gene:Mip / 39933 FlyBaseID:FBgn0036713 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001252154.1 Gene:nlp-38 / 173209 WormBaseID:WBGene00007219 Length:120 Species:Caenorhabditis elegans


Alignment Length:94 Identity:22/94 - (23%)
Similarity:26/94 - (27%) Gaps:56/94 - (59%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 GWNKFRGAWGKRE-----------PTWNNLKGMWGKRD--------------------------- 193
            ||||..|.||||.           ..||.|..:||||.                           
 Worm    27 GWNKAHGLWGKRSVQEASQDKRTPQNWNKLNSLWGKRSASSFDDDYTTENGDDDVTMLYKRSNLS 91

  Fly   194 ------------------QWQKLHGGWGK 204
                              |||:.:|.||:
 Worm    92 PRFLGRMTFARIPKISPAQWQRANGLWGR 120



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163838
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.