DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brv2 and F27C1.11

DIOPT Version :9

Sequence 1:NP_648970.2 Gene:brv2 / 39932 FlyBaseID:FBgn0036712 Length:736 Species:Drosophila melanogaster
Sequence 2:NP_001362170.1 Gene:F27C1.11 / 3565116 WormBaseID:WBGene00017858 Length:1271 Species:Caenorhabditis elegans


Alignment Length:362 Identity:69/362 - (19%)
Similarity:126/362 - (34%) Gaps:112/362 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 QEDPPYRAEEGGPTMDHIGYLKIRLRSLRSELLISEGHTNEMLNQKYKHIAGDLLLYGSYFIALM 140
            :|:.||| :.|....:.:|....::::......:.:.|...:..::.|.  .::|.|...||...
 Worm   504 EEEDPYR-DIGTAERERLGEAATKIQAAYKGYTVRKKHVQFLKEKERKE--QEILDYEKQFIHYT 565

  Fly   141 LMVVLQEDHTNYYNTNNMQRLFWDNTSVTFGL---SQVYFIYQVHSYMKITLVEAFYAQKTNGYE 202
            ..|:|..                     .|||   :.::|:....:...    |..|.|.    :
 Worm   566 FEVMLGN---------------------RFGLDFDTPLFFVLHGENGSS----EKIYTQA----D 601

  Fly   203 GW-------WAMEQW-------QKIGVVRLRQMRPVDCHIGLGKPEWDKKTY------------A 241
            .|       :..|.|       .|:||     :..:|  :|..:..:...|:            |
 Worm   602 DWLFLPSSCYDPESWILSSTRSLKLGV-----LTSID--VGHEQEGYGAGTFIDKIVITEDEKGA 659

  Fly   242 PEWRLPYHRMHYTEKFWRIYDPFVPAEFEPSFLNGLL---LNYDHYGYLLNYPEVA-GYVVLMMS 302
            .|.|    |.::..:.|          |:...::||:   :..:.:.||::..|.. |.|.....
 Worm   660 KECR----RFYFQVEKW----------FDSGQVDGLIVRNIKVNSFLYLVSSTERGEGVVERKKE 710

  Fly   303 TK---------INC--------LKQIEYLRDYSWL--DKNTSALFID---LTMYNAD-ANLFTLI 344
            ||         :|.        ||.|.| .|.:||  |....:|..|   :.....| .|:..|.
 Worm   711 TKGRWEFRLHTLNSDLGGTTSHLKIIGY-GDENWLADDIPNDSLLRDPSQVPRIQVDFGNIGRLQ 774

  Fly   345 TLRVENSPFGIQLPRVHVDSVSMLGNVETRSNSELLI 381
            .:|.|..|.|.| |..:::.|. ..:::||....|::
 Worm   775 KVRFEIQPAGDQ-PNYYLEYVE-AQDLDTRERCVLMV 809

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brv2NP_648970.2 PKD_channel 169..596 CDD:285288 55/269 (20%)
F27C1.11NP_001362170.1 DCX 26..94 CDD:340456
DUF2967 <89..>407 CDD:371408
PLAT 564..684 CDD:381752 26/169 (15%)
PLAT 713..823 CDD:238061 24/100 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.