DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brv2 and PRY

DIOPT Version :9

Sequence 1:NP_648970.2 Gene:brv2 / 39932 FlyBaseID:FBgn0036712 Length:736 Species:Drosophila melanogaster
Sequence 2:NP_001104126.3 Gene:PRY / 26067055 FlyBaseID:FBgn0267489 Length:1247 Species:Drosophila melanogaster


Alignment Length:350 Identity:64/350 - (18%)
Similarity:120/350 - (34%) Gaps:104/350 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 VYTVLVILFARGVFTKIWHHPAAAHEAWTMVDLAIYILNVFLTVLAIMRDIETDALLQIIETATK 448
            |||.|.:...|   |:::.| :.....:|..|:...:| :.:|.:..:.::|.|:...::.....
  Fly   791 VYTSLEVRMYR---TELYGH-SVLGVTFTQADIDFCVL-IRMTNIPKLNEMERDSSTCLVRAGVL 850

  Fly   449 GQ-----------------YL---DFQRPLR--LHQMLFIVKGFLVCITTLRLWKVLQFASVFQH 491
            .|                 ||   :...|..  .|...|.  .|...|.:.|:|...:....:|:
  Fly   851 KQTTLLLRNRCEKSQPVYIYLRAANISEPWNNFFHSGAFF--AFSTDIRSCRIWNYARPEPSWQN 913

  Fly   492 FTQTLFSAWRAVASL---------------------GVIILVVLMAIGITLAVP---NGNNAVVF 532
            |.        .:..|                     |:.|:.|.|.:...|..|   .....::|
  Fly   914 FA--------CMPELNKSIHFGIHCRCNYISDFDADGMPIIAVPMNLKCHLERPIVGQSYQIIIF 970

  Fly   533 SHMVQS-VVTCMWYSMGFNGD----IHPADFFHGGRILGILLYLALVFLLAIILMNVF------- 585
            ...:.| |:..::|||....|    ::...|..||:          .:...::||..|       
  Fly   971 FFSLSSFVIIYIFYSMQSVSDWDKKLYTELFPVGGK----------CYRGDLVLMCTFGGRYNAG 1025

  Fly   586 --ASVI--YDYFNETSRILKEHS------NRSSITFLEFLHVEYADLFGDAFRCLRKTYESRG-- 638
              |::|  :.:||:|..|:....      .|:|...|...:..:....|.|.|     :::.|  
  Fly  1026 TSANIIFAFKFFNQTRDIIVYQDPVFRTFKRNSTISLRLQNKHFCIPTGIAMR-----HDNSGVY 1085

  Fly   639 -HTVAENV---ELELNRRELIKFKR 659
             |....||   :|:.|..:|...::
  Fly  1086 PHFFCRNVVVCDLQTNEGQLFSIQQ 1110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brv2NP_648970.2 PKD_channel 169..596 CDD:285288 49/273 (18%)
PRYNP_001104126.3 REJ <189..452 CDD:280229
PLAT 1019..1111 CDD:294016 19/96 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1276906at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.