DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brv2 and Loxhd1

DIOPT Version :9

Sequence 1:NP_648970.2 Gene:brv2 / 39932 FlyBaseID:FBgn0036712 Length:736 Species:Drosophila melanogaster
Sequence 2:XP_006526497.1 Gene:Loxhd1 / 240411 MGIID:1914609 Length:2278 Species:Mus musculus


Alignment Length:308 Identity:67/308 - (21%)
Similarity:104/308 - (33%) Gaps:97/308 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 GPTMDHI-GYLKIRLRSLRSELLISEGHTNEMLNQKYKHIAGDLLLYGSYFIALMLMVVLQEDHT 150
            |||:..| |..:.|:.....||   ||...:.  ..|..:.||:...|...:             
Mouse   543 GPTVRRIMGMARYRVTVCTGEL---EGAGTDA--NVYLCLFGDVGDTGERLL------------- 589

  Fly   151 NYYNTNNMQRLFWDNTSVTFGLSQVYFIYQVHSYMKITLVEAFYAQKTNGYEGWWAMEQWQKIGV 215
              ||..|...||....:..|.:..|       :..|:..|...:..|.:| .||:       :..
Mouse   590 --YNCRNNTDLFEKGNADEFTIESV-------TMRKVRRVRVRHDGKGSG-SGWY-------LDR 637

  Fly   216 VRLRQMRPVDCHIGLGKPEWDKKTYAPEWRLPYHRMHYTEKFWRIYDPFVPAEFEPSFLNGLLLN 280
            |.:|:.         |:||.|...:      |..|....:|    .|..:..|..||..|..|.|
Mouse   638 VLVREE---------GQPESDNVEF------PCLRWLDKDK----DDGQLVRELLPSDSNATLKN 683

  Fly   281 YDHYGYLLNYPEVAG-------YVVLMMSTKINCLKQI-----EYLRDYSWLDKNTSALFIDLTM 333
            : .|...:...:|:|       |:.| ...|.:.:||:     ..|:||               .
Mouse   684 F-RYHISVKTGDVSGASTDSRVYIKL-YGEKSDTIKQVLLVSDNNLKDY---------------F 731

  Fly   334 YNADANLFTLITLRVENSPFGIQLPRVHV--DSVSM-----LGNVETR 374
            .....:.|||.||.:..      :.|:.:  ||..|     ||:|:.|
Mouse   732 ERGRVDEFTLETLNIGT------INRLVIGHDSTGMHAGWFLGSVQIR 773

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brv2NP_648970.2 PKD_channel 169..596 CDD:285288 48/225 (21%)
Loxhd1XP_006526497.1 PLAT_repeat 43..162 CDD:238854
PLAT_repeat 172..289 CDD:238854
PLAT_repeat 296..414 CDD:238854
PLAT_repeat 426..542 CDD:238854
PLAT_repeat 554..675 CDD:238854 33/174 (19%)
PLAT_repeat 684..805 CDD:238854 24/113 (21%)
PLAT 816..>896 CDD:381752
PLAT_repeat 1026..1146 CDD:238854
PLAT_repeat 1180..1300 CDD:238854
PLAT_repeat 1311..1437 CDD:238854
PLAT_repeat 1465..1585 CDD:238854
PLAT 1634..1749 CDD:381752
PLAT_repeat 1763..1880 CDD:238854
PLAT_repeat 1890..2010 CDD:238854
PLAT 2023..2124 CDD:381752
PLAT_repeat 2159..2277 CDD:238854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.