DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brv2 and LOXHD1

DIOPT Version :9

Sequence 1:NP_648970.2 Gene:brv2 / 39932 FlyBaseID:FBgn0036712 Length:736 Species:Drosophila melanogaster
Sequence 2:NP_001371403.1 Gene:LOXHD1 / 125336 HGNCID:26521 Length:2273 Species:Homo sapiens


Alignment Length:241 Identity:53/241 - (21%)
Similarity:83/241 - (34%) Gaps:76/241 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 YNTNNMQRLFWDNTSVTFGLSQVYFIYQVHSYMKITLVEAFYAQKTNGYEGWWAMEQWQKIGVVR 217
            ||..|...||....:..|.:..|       :...:..|...:..|.:| .||:       :..|.
Human   590 YNCRNNTDLFEKGNADEFTIESV-------TMRNVRRVRIRHDGKGSG-SGWY-------LDRVL 639

  Fly   218 LRQMRPVDCHIGLGKPEWDKKTYAPEWRLPYHRMHYTEKFWRIYDPFVPAEFEPSFLNGLLLNYD 282
            :|:.         |:||.|...:      |..|....:|    .|..:..|..||..:..|.|: 
Human   640 VREE---------GQPESDNVEF------PCLRWLDKDK----DDGQLVRELLPSDSSATLKNF- 684

  Fly   283 HYGYLLNYPEVAG-------YVVLMMSTKINCLKQI-----EYLRDYSWLDKNTSALFIDLTMYN 335
            .|...|...:|:|       |:.| ...|.:.:||:     ..|:||               ...
Human   685 RYHISLKTGDVSGASTDSRVYIKL-YGDKSDTIKQVLLVSDNNLKDY---------------FER 733

  Fly   336 ADANLFTLITLRVENSPFGIQLPRVHV--DSVSM-----LGNVETR 374
            ...:.|||.||.:.|      :.|:.:  ||..|     ||:|:.|
Human   734 GRVDEFTLETLNIGN------INRLVIGHDSTGMHASWFLGSVQIR 773

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brv2NP_648970.2 PKD_channel 169..596 CDD:285288 48/225 (21%)
LOXHD1NP_001371403.1 PLAT_repeat 44..162 CDD:238854
PLAT_repeat 172..289 CDD:238854
PLAT_repeat 296..414 CDD:238854
PLAT_repeat 425..542 CDD:238854
PLAT_repeat 554..675 CDD:238854 23/118 (19%)
PLAT_repeat 684..805 CDD:238854 26/113 (23%)
PLAT 816..>896 CDD:412108
PLAT_repeat 1022..1142 CDD:238854
PLAT_repeat 1175..1295 CDD:238854
PLAT_repeat 1306..1432 CDD:238854
PLAT_repeat 1460..1580 CDD:238854
PLAT 1629..1744 CDD:412108
PLAT_repeat 1758..1875 CDD:238854
PLAT_repeat 1885..2005 CDD:238854
PLAT 2018..2119 CDD:412108
PLAT_repeat 2154..2272 CDD:238854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.