DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brv2 and loxhd1b

DIOPT Version :9

Sequence 1:NP_648970.2 Gene:brv2 / 39932 FlyBaseID:FBgn0036712 Length:736 Species:Drosophila melanogaster
Sequence 2:XP_001920640.3 Gene:loxhd1b / 100150283 ZFINID:ZDB-GENE-081104-370 Length:2268 Species:Danio rerio


Alignment Length:226 Identity:39/226 - (17%)
Similarity:89/226 - (39%) Gaps:59/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 LMMSTKINCLKQIEYLRDYSWLDKNTSALFID----LTMYNADANLFTLITLRVEN-------SP 352
            ::.:|.|:.::::.|  :.:.:..:|.:...|    :|::.|:.:...::..:.|:       ..
Zfish  1741 ILDATTISIIRKVVY--EVTVVTGDTQSAGTDTNIFITVFGANGSTEEILLEKQEDRFERGQEDT 1803

  Fly   353 FGIQLP--------RVHVDSVS----------MLGNVETRSNSELLILFVYTVLVILFARGVFTK 399
            |.:::.        ||.:|...          :|.|:.|    :.|.:|.|...:........||
Zfish  1804 FSLEVDDIAPLKKLRVRIDGTGSRPDWFLDKMILRNLST----DELYVFTYEQWLSKTKGPKRTK 1864

  Fly   400 IWHHPAAAHEAWTMVDLAIYIL--------------NVFLTVLAIMRDIETDALLQIIETATKGQ 450
            :...||...:. .||:...|::              ||||.|.....|..|   |.:.|.:.:.:
Zfish  1865 VCELPAVVDDE-EMVEKTTYVIQVKTSDVTGGGTDANVFLIVFGENGDTGT---LALRECSNRNK 1925

  Fly   451 YLDFQRPL-RLHQMLFIVKGFLVCITTLRLW 480
            :...|..: |.:.:|.:.:     ::.:|:|
Zfish  1926 FERKQTDIFRFNDILSLGE-----LSKVRVW 1951

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brv2NP_648970.2 PKD_channel 169..596 CDD:285288 39/226 (17%)
loxhd1bXP_001920640.3 PLAT_repeat 96..215 CDD:238854
PLAT_repeat 225..342 CDD:238854
PLAT_repeat 349..467 CDD:238854
PLAT_repeat 478..595 CDD:238854
PLAT_repeat 606..727 CDD:238854
PLAT_repeat 737..858 CDD:238854
PLAT_repeat 867..1020 CDD:238854
PLAT_repeat 1028..1146 CDD:238854
PLAT_repeat 1173..1293 CDD:238854
PLAT_repeat 1304..1431 CDD:238854
PLAT_repeat 1458..1578 CDD:238854
PLAT 1624..1741 CDD:294016 39/226 (17%)
PLAT_repeat 1753..1871 CDD:238854 19/123 (15%)
PLAT_repeat 1881..2001 CDD:238854 15/79 (19%)
PLAT 2014..2118 CDD:279778
PLAT_repeat 2149..2267 CDD:238854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.