DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or74a and Or98a

DIOPT Version :9

Sequence 1:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:349 Identity:63/349 - (18%)
Similarity:121/349 - (34%) Gaps:104/349 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 ILVEMQIRCFQLAWHKDRF----------RALLQRFYAEIYVSEEMEPHLFASIQRQM------- 135
            :|.||..||..|   |:|.          :|.|  .|..||.:..:...|.|::..::       
  Fly   111 LLSEMDKRCTTL---KERVEVHQGVVRCNKAYL--IYQFIYTAYTISTFLSAALSGKLPWRIYNP 170

  Fly   136 -LATRVNSTVYLLALLN---FFLVPVTNVIYHRREMLYKQVYPFDNTQLHFFIPLLVLNFWVGFI 196
             :..|.:.:.:..|.||   ..|..||       :.|...:||                      
  Fly   171 FVDFRESRSSFWKAALNETALMLFAVT-------QTLMSDIYP---------------------- 206

  Fly   197 ITSMLFGELNVMGELMMHLNARYIQL-------GQDLRRSAQMLLKKSSSLNVAIAYRLNLTHIL 254
               :|:|.:     |.:||....:::       |:....:.|.|:|.....|:.|          
  Fly   207 ---LLYGLI-----LRVHLKLLRLRVESLCTDSGKSDAENEQDLIKCIKDHNLII---------- 253

  Fly   255 RRNAALRDFGQRVEKEFTLRIFVMF-----AFSAGLLCALFFKAFTNPWGNVAYIVWFLAKFMEL 314
                   |:...:....|..|||.|     .....::..||   |.:.|..:|.:.:.....::.
  Fly   254 -------DYAAAIRPAVTRTIFVQFLLIGICLGLSMINLLF---FADIWTGLATVAYINGLMVQT 308

  Fly   315 LALGMLGSILLKTTDELGMMYYTADWEQVIHQSDNVGENVKLMKLVTLAIQLNSRPFFITGLNYF 379
            .....:..:|.|..:.|....:.::|   |:.|.:...:::..      ::...:....|..:.|
  Fly   309 FPFCFVCDLLKKDCELLVSAIFHSNW---INSSRSYKSSLRYF------LKNAQKSIAFTAGSIF 364

  Fly   380 RVSLTAVLKIIQGAFSYFTFLNSM 403
            .:|..:.:|:.:.|||..||:|.:
  Fly   365 PISTGSNIKVAKLAFSVVTFVNQL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 57/338 (17%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 57/338 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465998
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.