DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or74a and Orco

DIOPT Version :9

Sequence 1:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster


Alignment Length:449 Identity:83/449 - (18%)
Similarity:148/449 - (32%) Gaps:145/449 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VFCEHNEVDFHYLIANRQDMD---NMLTGLPTYLILVEMQIRCFQLAWHKDRFRALLQRFYAEIY 118
            :|..|....|.||..|:::..   |:...:.|:.:..|...|...:|..|.|             
  Fly    82 LFFTHCITKFIYLAVNQKNFYRTLNIWNQVNTHPLFAESDARYHSIALAKMR------------- 133

  Fly   119 VSEEMEPHLFASIQRQMLATRVNSTVYLLALLNFFLVPVTNVIYHRR---------EMLYKQVYP 174
                   .||..:   ||.|..::|.:  ..:.||...|..|:.|..         .:..|..||
  Fly   134 -------KLFFLV---MLTTVASATAW--TTITFFGDSVKMVVDHETNSSIPVEIPRLPIKSFYP 186

  Fly   175 FDNTQLHFFIPLLVLNFWVGFIITSMLFGEL-NVM--------GELMMHLN-------------- 216
            ::.:...|:  ::...|.:.:::.||:...| :||        .|.:.||.              
  Fly   187 WNASHGMFY--MISFAFQIYYVLFSMIHSNLCDVMFCSWLIFACEQLQHLKGIMKPLMELSASLD 249

  Fly   217 -------ARYIQL----------------GQDLRRS----------AQM---------------- 232
                   |.:..|                |.|:..|          ||.                
  Fly   250 TYRPNSAALFRSLSANSKSELIHNEEKDPGTDMDMSGIYSSKADWGAQFRAPSTLQSFGGNGGGG 314

  Fly   233 -----------LLKKSSSL-NVAIAYRLNL-THILRRNAALRD-FGQRVEKEF---TLRIFVMFA 280
                       |.||...: ..||.|.:.. .|::|..||:.| :|..:....   |::: .:.|
  Fly   315 NGLVNGANPNGLTKKQEMMVRSAIKYWVERHKHVVRLVAAIGDTYGAALLLHMLTSTIKL-TLLA 378

  Fly   281 FSAGLLCALFFKAFTNPWGNVAYIVWFLAKFMELLALGMLGSILLKTTDELGMMYYTADWEQVIH 345
            :.|..:..:...|||    .|.|:.:.||:.....   :.|:.|::.:..:....|:..|.    
  Fly   379 YQATKINGVNVYAFT----VVGYLGYALAQVFHFC---IFGNRLIEESSSVMEAAYSCHWY---- 432

  Fly   346 QSDNVGENVKLMKLVTLAIQLNSRPFFITGLNYFRVSLTAVLKIIQGAFSYFTFLNSMR 404
               :..|..|  ..|.:..|...:...|:|..:|.|||.....::....:||..|..::
  Fly   433 ---DGSEEAK--TFVQIVCQQCQKAMSISGAKFFTVSLDLFASVLGAVVTYFMVLVQLK 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 74/419 (18%)
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 80/433 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.