DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or74a and Or71a

DIOPT Version :9

Sequence 1:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster


Alignment Length:243 Identity:54/243 - (22%)
Similarity:96/243 - (39%) Gaps:40/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 PFDNTQLHFFIPLLVLNFWVGFI---ITSMLFGELNVMGE-----LMMHLNARYIQLGQDLRRSA 230
            |||..|     |:|   ||..||   .|..:....||..:     ||:||:.....|||.|.:  
  Fly   161 PFDWQQ-----PVL---FWYAFIYQATTIPIACACNVTMDAVNWYLMLHLSLCLRMLGQRLSK-- 215

  Fly   231 QMLLKKSSSLNVAIAYRLNLTHILRRNAALRDFGQRVEKEFTLRIFVMFAFSAGLLCALFFKAFT 295
              |......|....   |.|.|:.:|   |:.....:|...:...|.....|:.::|...:....
  Fly   216 --LQHDDKDLREKF---LELIHLHQR---LKQQALSIEIFISKSTFTQILVSSLIICFTIYSMQM 272

  Fly   296 NPW-----GNVAYIVWFLAKFMELLALGMLGSILLKTTDELGMMYYTADWEQVIHQSDNVGENVK 355
            :|.     |..|.:.:.:|..|:::...:.|:.::.:.:.|....|.:||..:         |.:
  Fly   273 SPVLQDLPGFAAMMQYLVAMIMQVMLPTIYGNAVIDSANMLTDSMYNSDWPDM---------NCR 328

  Fly   356 LMKLVTLAIQLNSRPFFITGLNYFRVSLTAVLKIIQGAFSYFTFLNSM 403
            :.:||.:.:...:||..:....:|.:.|....|.:..|:|....|.:|
  Fly   329 MRRLVLMFMVYLNRPVTLKAGGFFHIGLPLFTKTMNQAYSLLALLLNM 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 50/232 (22%)
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 50/232 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466208
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.