DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or74a and Or67b

DIOPT Version :9

Sequence 1:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:397 Identity:71/397 - (17%)
Similarity:149/397 - (37%) Gaps:114/397 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 MDNMLTGLPTYLILVEMQIRCFQLAWHKDRFRALLQRFYAEIYVSEEMEPHLFASIQRQMLAT-- 138
            |:|.:....||   ||..:..|||:      ..:::.|:.:..| |.....:|::...::|.:  
  Fly    67 MENYMISFETY---VEAVLLTFQLS------VGVVKMFHFQNKV-ESCSQLVFSTETGEVLKSLG 121

  Fly   139 ----------RVNSTVYLLALLN----------FFLVPVTNVIYH-------------------- 163
                      .:.|:|.|:.|.|          ||.:....|:|:                    
  Fly   122 LFQLDLPRKKELLSSVSLILLNNWMIIDRQVMFFFKIVCMPVLYYCVRPYFQYIFDCYIKDKDTC 186

  Fly   164 RREMLYKQVYPFDNTQL-HFFIPLLVLNF--------WVGFIITSMLFGELNVMGELMMHLNARY 219
            ...:.|..:.|:  .|| ::..|..|:.|        |..|.:    ||           .|:.:
  Fly   187 EMTLTYPAIVPY--LQLGNYEFPSYVIRFFLLQSGPLWCFFAV----FG-----------FNSLF 234

  Fly   220 IQLGQ---DLRRSAQMLLKKSSSLNVAIAYRLNLTHI---LRRNAALRDFGQRVEKEFTLRIFVM 278
            :.|.:   .|.:..:.|::.|:| ::.:.....:.::   :|..|.:.....::|..|...|.|.
  Fly   235 VVLTRYESGLIKVLRFLVQNSTS-DILVPKDQRVKYLQCCVRLFARISSHHNQIENLFKYIILVQ 298

  Fly   279 FAFSAGLLCALFFKAFTNPWGNVAYIVWFLAKFMELLALGMLGSILLKTTDELGMMYYTADWEQV 343
            .:.|:.|:|.|.:|..|     |..:.|        :.:||:  ::...|..|.:..|....::|
  Fly   299 CSVSSILICMLLYKIST-----VLEVGW--------VWMGMI--MVYFVTIALEITLYNVSAQKV 348

  Fly   344 IHQSD------------NVGENVKLMKLVTLAIQLNSRPFFITGLNYFRVSLTAVLKIIQGAFSY 396
            ..||:            |.....|.|  :.:.:..:.|.|.::...:..:|...::::.:.:.::
  Fly   349 ESQSELLFHDWYNCSWYNESREFKFM--IKMMLLFSRRTFVLSVGGFTSLSHKFLVQVFRLSANF 411

  Fly   397 FTFLNSM 403
            |..|.:|
  Fly   412 FLLLRNM 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 68/386 (18%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 44/245 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465381
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.