DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or74a and Or59c

DIOPT Version :9

Sequence 1:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster


Alignment Length:451 Identity:85/451 - (18%)
Similarity:154/451 - (34%) Gaps:127/451 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ELAPMPWPVS-------LYRVLNHVAW-PLEAESGRW--------TVFLDRLMIFLGF-LVFCEH 61
            :.||:...||       .||:...:.| |.:....||        |::|..:.:.||. |.:.:|
  Fly    10 QTAPLDQEVSSLDASDYYYRIAFFLGWTPPKGALLRWIYSLWTLTTMWLGIVYLPLGLSLTYVKH 74

  Fly    62 NEVDFHYLIANRQDMDNMLTGLPT-YLILVEMQIRC----------FQLAWHKDRFRALLQRFYA 115
                          .|..   .|| :|..:::.|.|          :...|   |||.:.:    
  Fly    75 --------------FDRF---TPTEFLTSLQVDINCIGNVIKSCVTYSQMW---RFRRMNE---- 115

  Fly   116 EIYVSEEMEPHLFASIQRQM---LATRVNSTV--YLLALLNF-FLVPVTNVIYHRRE-MLYKQVY 173
               :...::.....:.||::   :..|||..|  :|...|.| ||...|:|...:.. .||..: 
  Fly   116 ---LISSLDKRCVTTTQRRIFHKMVARVNLIVILFLSTYLGFCFLTLFTSVFAGKAPWQLYNPL- 176

  Fly   174 PFDNTQLHFFIPLLVLNFWVGFIITSMLFGELNVMGELMMH----------------LNARYIQL 222
             .|..:.|:       ..|:..|:...:. .:..|.|||..                |..|...|
  Fly   177 -VDWRKGHW-------QLWIASILEYCVV-SIGTMQELMSDTYAIVFISLFRCHLAILRDRIANL 232

  Fly   223 GQDLRRSAQMLLKKSSSLNVAIAYRLNLTHILRRNAALRDF------GQRVEKEFTLRIFVMFAF 281
            .||.:.|                   .:.|..:..|.::|.      .|.:....::.||..|..
  Fly   233 RQDPKLS-------------------EMEHYEQMVACIQDHRTIIQCSQIIRPILSITIFAQFML 278

  Fly   282 SAGL---LCALFFKAFTNP-WGNVAYIVWFLAKFMELLALGMLGSILLKTTDELGMMYYTADWEQ 342
             .|:   |.|:....|.|. |..:|.:.:.:|...|.....||...|::.:..:....:.::|  
  Fly   279 -VGIDLGLAAISILFFPNTIWTIMANVSFIVAICTESFPCCMLCEHLIEDSVHVSNALFHSNW-- 340

  Fly   343 VIHQSDNVGENVKLMKLVTLAIQLNSRPFFITGLNYFRVSLTAVLKIIQGAFSYFTFLNSM 403
                   :..:......|...:....:|...|..:.|.:|:.:.:.:.:.||:..|.:|.|
  Fly   341 -------ITADRSYKSAVLYFLHRAQQPIQFTAGSIFPISVQSNIAVAKFAFTIITIVNQM 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 64/362 (18%)
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 63/354 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465972
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.