DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or74a and Or59b

DIOPT Version :9

Sequence 1:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster


Alignment Length:433 Identity:87/433 - (20%)
Similarity:157/433 - (36%) Gaps:115/433 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VSLYRVLNHVAWPLEAESGRWTVFLDRLMIFLGFLVFCEHNEVDFHYLIANRQDMDN-----MLT 81
            :.|||.:..:.|....|.....|:|....:...|.||    .:...::|:..|:..|     .||
  Fly    23 IYLYRAMWLIGWIPPKEGVLRYVYLFWTCVPFAFGVF----YLPVGFIISYVQEFKNFTPGEFLT 83

  Fly    82 GLP--------------TYLILVEMQIRCFQLAWHKDRFRALLQRFYAEIYVSEEMEPHLFASIQ 132
            .|.              |||.|           |...:...||          :.::..|.....
  Fly    84 SLQVCINVYGASVKSTITYLFL-----------WRLRKTEILL----------DSLDKRLANDSD 127

  Fly   133 RQMLATRVNSTVYLLALLNF-FLVPVTNVIYHRREMLYKQVY--PFDNTQLHFFI----PLLVLN 190
            |:    |:::   ::|..|: ||:             |..:|  ...:|.|.:.:    |..|.|
  Fly   128 RE----RIHN---MVARCNYAFLI-------------YSFIYCGYAGSTFLSYALSGRPPWSVYN 172

  Fly   191 -----------FWVGFI---IT---SMLFGELNVMGELMMHLNAR-YIQLGQDLRRSAQMLLKKS 237
                       .|:..|   ||   ::|..:|:....||..:..| ::::.:|..||.:|..::|
  Fly   173 PFIDWRDGMGSLWIQAIFEYITMSFAVLQDQLSDTYPLMFTIMFRAHMEVLKDHVRSLRMDPERS 237

  Fly   238 SSLNVAIAYRLNLTH--ILRRNAALRDFGQRVEKEFTLRIFVMFAFSAGL----LCALFFKAFTN 296
            .:.|........|.|  ||:....:|....|.       |||.||....:    |..:||  |:|
  Fly   238 EADNYQDLVNCVLDHKTILKCCDMIRPMISRT-------IFVQFALIGSVLGLTLVNVFF--FSN 293

  Fly   297 PWGNVAYIVWFLAKFMELLALGMLGSILLKTTDELGMMYYTADWEQVIHQSDNVGENVKLMKLVT 361
            .|..||.:::.:...::........::|:....:|....:.::|         |....:....:.
  Fly   294 FWKGVASLLFVITILLQTFPFCYTCNMLIDDAQDLSNEIFQSNW---------VDAEPRYKATLV 349

  Fly   362 LAIQLNSRP-FFITGLNYFRVSLTAVLKIIQGAFSYFTFLNSM 403
            |.:....:| .||.| ..|.:|:.:.:.:.:.|||..|.:..|
  Fly   350 LFMHHVQQPIIFIAG-GIFPISMNSNITVAKFAFSIITIVRQM 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 70/369 (19%)
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 69/364 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465946
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.