DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or74a and Or56a

DIOPT Version :9

Sequence 1:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:403 Identity:83/403 - (20%)
Similarity:146/403 - (36%) Gaps:134/403 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DNMLTGLPTYLILVE---MQIRCFQLAWHKDRFRALLQRFYAEI----YVSEEMEPHLFASIQRQ 134
            :|:..|..:|...|:   :.|..|.....:|:..:||:..:::|    :.::..|..|..:.|..
  Fly    70 ENLNDGATSYATAVQYFAVSIAMFNAYVQRDKVISLLRVAHSDIQNLMHEADNREMELLVATQAY 134

  Fly   135 MLATRVNSTVYLLALL----------------NFFL-VPVTNVIYHRR----EMLYKQVYPF--- 175
               ||   |:.||..:                :.|| ..|.||...||    .:|..|::||   
  Fly   135 ---TR---TITLLIWIPSVIAGLMAYSDCIYRSLFLPKSVFNVPAVRRGEEHPILLFQLFPFGEL 193

  Fly   176 -DNTQLHFFIP-------LLVLNFWVGFIITSMLFGELNVMGELMMHLNARYIQLGQDLRRSAQM 232
             ||..:.:..|       :..:..|..||...|                 :|:.|      ..|:
  Fly   194 CDNFVVGYLGPWYALGLGITAIPLWHTFITCLM-----------------KYVNL------KLQI 235

  Fly   233 LLKKSSSLNVAIAYRLNLTHILRRNAA-------LRDFGQRVEKEFTLRIFVM------------ 278
            |.|:...:::.   |||...::.|..|       ::.|.:.|:::..:|.||.            
  Fly   236 LNKRVEEMDIT---RLNSKLVIGRLTASELTFWQMQLFKEFVKEQLRIRKFVQELQYLICVPVMA 297

  Fly   279 -FAFSAGLLCALFFKAFTNPWGNVAYIVWFLAKFMELLALGML------GSILLKTTDELGMMYY 336
             |...:.|:|.|||.........:.|...|:..|   :..|:|      .:::::..|||.:.|:
  Fly   298 DFIIFSVLICFLFFALTVGVPSKMDYFFMFIYLF---VMAGILWIYHWHATLIVECHDELSLAYF 359

  Fly   337 TADWE------------QVIHQSDNVGENVKLMKLVTLAIQLNSRPFFITGLNYFRVSLTAVLKI 389
            :..|.            .::|..       :.||:..|.:.||.|.|...|              
  Fly   360 SCGWYNFEMPLQKMLVFMMMHAQ-------RPMKMRALLVDLNLRTFIDIG-------------- 403

  Fly   390 IQGAFSYFTFLNS 402
             :||:|||..|.|
  Fly   404 -RGAYSYFNLLRS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 77/393 (20%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 66/337 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.