DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or74a and Or49a

DIOPT Version :9

Sequence 1:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:412 Identity:69/412 - (16%)
Similarity:147/412 - (35%) Gaps:103/412 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PMPWPVSLYRVLNHVAWPLEAESGRWTVFLDRLMIFLGFLVFCEHNEVDFHYLIANRQDMDNMLT 81
            |.||                     |     |.::..|:.|.|..:......::..|......|.
  Fly    29 PKPW---------------------W-----RYLLVRGYFVLCTISNFYEASMVTTRIIEWESLA 67

  Fly    82 GLPT--------YLILVEMQIRCFQLAWHKDRFRALLQRFYAEIYVSEEMEPHLFASIQRQML-- 136
            |.|:        :..::..|::......::.|...|..|. .|:|..:|.....: .:.:..|  
  Fly    68 GSPSKIMRQGLHFFYMLSSQLKFITFMINRKRLLQLSHRL-KELYPHKEQNQRKY-EVNKYYLSC 130

  Fly   137 ATRVNSTVYLLALLNFFLVPVTN------VIYHRREMLYKQVYP----FDNTQLHFFIPLLVLNF 191
            :||....||...::...|.|:..      :.:.:.:..||:::|    ||:.:...::...|::|
  Fly   131 STRNVLYVYYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFDSEKPLGYVLAYVIDF 195

  Fly   192 -WVGFIITSMLFGELNVMGELMMHLNARYIQLGQDLRRSAQMLLKKSSSLNVAIAYRLNLTHILR 255
             :..||:.                     :.||.||     .::..||.:::.:.|..|:...:|
  Fly   196 TYSQFIVN---------------------VSLGTDL-----WMMCVSSQISMHLGYLANMLASIR 234

  Fly   256 RNAALR----DFGQRVEKEFTLRIFV---------------MFAFSAGLLCALFF---KAFTNPW 298
            .:....    ||...:.|...|.|.:               :|..|..|.|..::   :.|.  |
  Fly   235 PSPETEQQDCDFLASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGFN--W 297

  Fly   299 GNVAYIVWFLAKFMELLALGMLGSILLKTTDELGMMYYTADW-EQVIHQSDNVGENVKLMKLVTL 362
            ..::|::.|.:...:...:...|.:|:..:..|....:.:.| |..:.....:   :.||.....
  Fly   298 EGISYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEI---LILMAQAQR 359

  Fly   363 AIQLNSRPFFITGLNYFRVSLT 384
            .:::::|...|..|:.|::.:|
  Fly   360 PLEISARGVIIISLDTFKILMT 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 60/354 (17%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 56/327 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472821
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.