DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or74a and Or47b

DIOPT Version :9

Sequence 1:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster


Alignment Length:385 Identity:73/385 - (18%)
Similarity:142/385 - (36%) Gaps:107/385 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFHRYRPRL------PGGELAPMPWPVSLYRVLNHVAWPLEAESGRWTVFL------------D 47
            ::|:..|..|      |..:||.:|    |||.:| :.......:..||:|:            |
  Fly    35 LAFYYVRAFLSLLCQYPNKKLASLP----LYRWIN-LFIMCNVMTIFWTMFVALPESKNVIEMGD 94

  Fly    48 RLMIFLGF-LVFCEHNEVDFHYLIANRQDMDNMLTGLPTYLILVEMQIRCFQLAWHKDRFRALLQ 111
            .|:...|. |||.:                            :..|.:||       |....|:.
  Fly    95 DLVWISGMALVFTK----------------------------IFYMHLRC-------DEIDELIS 124

  Fly   112 RFYAEIYVSEEMEPHLFASIQRQMLATR-----VNSTVYL--LALLNFFLVPV-TNVIYHRREML 168
            .|.   |.:.|:.||   :|..::|..:     :.|.:|:  ..|:|||...: ...:....::.
  Fly   125 DFE---YYNRELRPH---NIDEEVLGWQRLCYVIESGLYINCFCLVNFFSAAIFLQPLLGEGKLP 183

  Fly   169 YKQVYPFD--NTQLHFFIPLLVLNFWVGFIITSMLFGELNVMGELMMHL--NARYIQLGQDLRRS 229
            :..||||.  ...||.:      .||..:|..| |..:.|:|..||:.:  .:.::|...:|:..
  Fly   184 FHSVYPFQWHRLDLHPY------TFWFLYIWQS-LTSQHNLMSILMVDMVGISTFLQTALNLKLL 241

  Fly   230 AQMLLKKSSSLNVA-----------IAYRLNLTHIL-RRNAALRD-FGQRVEKEFTLRIFVMFAF 281
            . :.::|...:.|:           :.:..::..:: :.|.|... |..::...|:|.....|..
  Fly   242 C-IEIRKLGDMEVSDKRFHEEFCRVVRFHQHIIKLVGKANRAFNGAFNAQLMASFSLISISTFET 305

  Fly   282 SAGLLCALFFKAFTNPWGNVAYIVWFLAKFMELLALGMLGSILLKTTDELGMMYYTA-DW 340
            .|.        |..:|.....:::..|..|::|....:.|:::...:.|:....:.. ||
  Fly   306 MAA--------AAVDPKMAAKFVLLMLVAFIQLSLWCVSGTLVYTQSVEVAQAAFDINDW 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 53/292 (18%)
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 59/327 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465433
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.