DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or74a and Or22a

DIOPT Version :9

Sequence 1:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster


Alignment Length:414 Identity:81/414 - (19%)
Similarity:157/414 - (37%) Gaps:86/414 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VSLYRVLNHVAWPLEAESGRWTV-------FLDRLMIFLGFLVFCEHNEVDFHYLIANRQ-DMDN 78
            :.|.||:....| .|.|:.||.:       |::.:|:.|..:      .:...||...:. ....
  Fly    25 IYLDRVMWSFGW-TEPENKRWILPYKLWLAFVNIVMLILLPI------SISIEYLHRFKTFSAGE 82

  Fly    79 MLTGLPTYLILVEMQIRC-FQLAWHKDRFRALLQRFYAEIYVSEEMEPHLFASIQRQMLATRVNS 142
            .|:.|...:.:.....:| |.|...|.|..|.:                |...:.::.|:.:..|
  Fly    83 FLSSLEIGVNMYGSSFKCAFTLIGFKKRQEAKV----------------LLDQLDKRCLSDKERS 131

  Fly   143 TVY-LLALLNFFLVPVTNVIYH----------------RREMLYKQVYPFDNTQLHFFIPLLVLN 190
            ||: .:|:.|||     :::||                .|...::..:|:.::...|:|..:.  
  Fly   132 TVHRYVAMGNFF-----DILYHIFYSTFVVMNFPYFLLERRHAWRMYFPYIDSDEQFYISSIA-- 189

  Fly   191 FWVGFIITSMLFGEL--NVMGELMMHLNARYIQLGQDLRRSAQMLLKKSSSLNVAIAYRLNLTHI 253
              ..|::|..::.:|  :|...:.|.:...:|.|   |::..:.|..|..  .....|...||..
  Fly   190 --ECFLMTEAIYMDLCTDVCPLISMLMARCHISL---LKQRLRNLRSKPG--RTEDEYLEELTEC 247

  Fly   254 LRRNAALRDFGQRVEKEFTLRIFVMF-----AFSAGLLCALFFKAFTNPWGNVAYIVWFLAKFME 313
            :|.:..|.|:...:...|:..|||.|     .....::..:||..|   |..||..::.....||
  Fly   248 IRDHRLLLDYVDALRPVFSGTIFVQFLLIGTVLGLSMINLMFFSTF---WTGVATCLFMFDVSME 309

  Fly   314 LLALGMLGSILLKTTDELGMMYYTADWEQVIHQSDNVGENVKLMKLVTLAIQLNS--RPFFITGL 376
            ......|.::::....|:....:.:||.....:..:           ||...|::  :|..:|..
  Fly   310 TFPFCYLCNMIIDDCQEMSNCLFQSDWTSADRRYKS-----------TLVYFLHNLQQPITLTAG 363

  Fly   377 NYFRVSLTAVLKIIQGAFSYFTFL 400
            ..|.:|:...|.:::.|||..|.:
  Fly   364 GVFPISMQTNLAMVKLAFSVVTVI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 64/345 (19%)
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 64/343 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466011
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.