DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or74a and Or10a

DIOPT Version :9

Sequence 1:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:441 Identity:86/441 - (19%)
Similarity:150/441 - (34%) Gaps:100/441 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PRL--------PGGELAPMPWPVSLYRVLNHVAWPLEAESGRWTVFLDRLMIFLGFLVFCEHNE- 63
            |||        ||......||...::..:..:....|..:|  ..||||..|.|.....|.... 
  Fly    22 PRLSLDIMGYWPGKTGDTWPWRSLIHFAILAIGVATELHAG--MCFLDRQQITLALETLCPAGTS 84

  Fly    64 ----VDFHYLIANRQDMD---NMLTGLPTYLILVEMQIRCFQLAWHKDRFRALLQRFYAEIYVSE 121
                :....::..|||:.   |.|.||            .|...|.:...|.:            
  Fly    85 AVTLLKMFLMLRFRQDLSIMWNRLRGL------------LFDPNWERPEQRDI------------ 125

  Fly   122 EMEPHLFASIQRQMLATRVNSTVYLLALLNFFLVPVTNVIYHRREMLYKQVYPFDN--------T 178
                    .::...:|.|:|   :......||    |...|:.:.:|...:....|        |
  Fly   126 --------RLKHSAMAARIN---FWPLSAGFF----TCTTYNLKPILIAMILYLQNRYEDFVWFT 175

  Fly   179 QLHFFIPLLVLNF-----------WVGFIITSMLFGELNVMGELMMHLNARYIQLGQDLRRSAQM 232
            ..:..:|.::||:           :.|::...|..|......|...||:|    |.:.|:...:.
  Fly   176 PFNMTMPKVLLNYPFFPLTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSA----LFEVLQAEIES 236

  Fly   233 LLK------KSSSLNVAIAYRLNLTHILRRNAAL---RDFGQRVEKEFTLRIFVMFAFSAGLLCA 288
            :.:      :.|.:.:.|..:...:.|:|.||.:   |.|..|. ...||..||..|...|....
  Fly   237 MFRPYTDHLELSPVQLYILEQKMRSVIIRHNAIIDLTRFFRDRY-TIITLAHFVSAAMVIGFSMV 300

  Fly   289 LFFKAFTNPWGNVAYIVWFLAKFMELLALGMLGSILLKTTDELGMMYYTADWEQVIHQSDNVGEN 353
            .......|..|.:.|:.:.:|...:||.....|:::.:::..|....::..|:..         .
  Fly   301 NLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLF---------K 356

  Fly   354 VKLMKLVTLAIQLNSRPFFITGLNYFRVSLTAVLKIIQGAFSYFTFLNSMR 404
            .|..:||.|.|..:.||..: .:.:|..||.....|:|.:.|....:.|.:
  Fly   357 PKQRRLVQLLILRSQRPVSM-AVPFFSPSLATFAAILQTSGSIIALVKSFQ 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 66/349 (19%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 71/379 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465329
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.